Antibodies

Jump to Filters
View as table Download
BDNF Rabbit Polyclonal Antibody
TA328615

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).
BAX Rabbit Polyclonal Antibody
TA590174

USD 409.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody
TA309191

USD 415.00

In Stock

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit
BDNF Rabbit Polyclonal Antibody
TA328614

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.
TRPC1 Rabbit Polyclonal Antibody
TA328677

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPC1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular.
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 375.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
NDUFA4L2 Rabbit Polyclonal Antibody
TA315629

USD 345.00

In Stock

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.
BAX Rabbit Polyclonal Antibody
TA890001

USD 345.00

In Stock

Rabbit polyclonal BAX Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.
BAX Rabbit Polyclonal Antibody
TA890001S

USD 159.00

In Stock

Rabbit polyclonal BAX Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Special Offer: Get this product for $99/€99. Use code: "Truesample".