Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

CAT#: TA335305

Rabbit Polyclonal Anti-UCRC Antibody

Product Images

WB Suggested Anti-UCRC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: MCF7 cell lysate.UQCR10 is supported by BioGPS gene expression data to be expressed in MCF7

• 

  Rabbit Anti-UQCR10 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 7 kDa
• Gene Name: ubiquinol-cytochrome c reductase, complex III subunit X
• Database Link:
  NP_037519
  Entrez Gene 29796 Human
  UniProt ID Q9UDW1
• Background: UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]). [supplied by OMIM]
• Synonyms: HSPC051; HSPC119; HSPC151; QCR9; UCCR7.2; UCRC
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease