Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-AHCY Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-DNMT3A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |