Antibodies

View as table Download

Rabbit Polyclonal Anti-AGPAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGPAT2 Antibody: synthetic peptide directed towards the C terminal of human AGPAT2. Synthetic peptide located within the following region: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA

Anti-AGPAT2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2