Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB2. |
Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB2. |
beta 2 Adrenergic Receptor (ADRB2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 311-360 of Human AR-β2. |
Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human:S346 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ADRB2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ADRB2. |
Rabbit Polyclonal Anti-ADRB2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ADRB2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (88%); Mouse (81%). |
ADRB2 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ADRB2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey, Marmoset (94%). |
Rabbit Polyclonal Adrenergic Receptor beta2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 |
Rabbit Polyclonal Anti-ADRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN |
Rabbit Polyclonal Anti-ADRB2 Antibody (Transmembrane Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | ADRB2 antibody was raised against synthetic 16 amino acid peptide from 5th transmembrane domain of human ADRB2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Pufferfish, Zebrafish, Stickleback (94%); Marmoset, Mouse, Rat, Hamster (88%); Bovine, Dog, Cat, Elephant, Pig, Guinea pig, Xenopus (81%). |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface |