Antibodies

View as table Download

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688)

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the N-terminal region of Human SGSH. Synthetic peptide located within the following region: RNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSCSP

Rabbit Polyclonal Anti-SGSH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SGSH antibody is: synthetic peptide directed towards the C-terminal region of Human SGSH. Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688)

SGSH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 427~457 amino acids from the C-terminal region of Human SGSH.