Antibodies

View as table Download

Rabbit Polyclonal GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3.

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit polyclonal anti-GATA3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human GATA3.

Rabbit Polyclonal GATA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA3

Rabbit Polyclonal GATA3 (Ser308) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA3 around the phosphorylation site of Serine 308
Modifications Phospho-specific

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit Polyclonal anti-GATA3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3. Synthetic peptide located within the following region: MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVC