GATA3 Rabbit Polyclonal Antibody

CAT#: TA329424

Rabbit Polyclonal anti-GATA3 antibody

Product Images

WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: GATA3; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: GATA3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: GATA3; Sample Tissue: MCF7; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:1ug/ml; Peptide Concentration: 5.0 ug/ml; Lysate Quantity: 25ug/lane/lane; Gel Concentration: 12%

• 

  Host: Rabbit; Target Name: GATA3; Sample Tissue: MCF7; Antibody Dilution: 1.0ug/ml; GATA3 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-GATA3 antibody

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3. Synthetic peptide located within the following region: MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: GATA binding protein 3
• Database Link:
  NP_002042
  Entrez Gene 2625 Human
  UniProt ID P23771
• Background: GATA3 is crucially involved in IL-5 gene transcription in human peripheral CD4-positive t cells. This gene is involved in growth control and the maintenance of the differentiated state in epithelial cells and may contribute to tumorigenesis in breast cancer.
• Synonyms: HDR; HDRS
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors