Antibodies

View as table Download

Rabbit polyclonal anti-SFRP1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SFRP1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a 12 aa region of human Sfrp1 protein.

Rabbit Polyclonal Anti-SFRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT

Anti-SFRP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 42-58 amino acids of Human secreted frizzled-related protein 1

Anti-SFRP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 287-300 amino acids of human secreted frizzled-related protein 1