SFRP1 Rabbit Polyclonal Antibody

CAT#: TA330411

Rabbit Polyclonal Anti-SFRP1 Antibody

Product Images

WB Suggested Anti-SFRP1 Antibody Titration: 0.3 ug/ml; ELISA Titer: 1:62500; Positive Control: Human kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: secreted frizzled related protein 1
• Database Link:
  NP_003003
  Entrez Gene 6422 Human
  UniProt ID Q8N474
• Background: This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina. [provided by RefSeq, Sep 2009]
• Synonyms: FRP; FRP-1; FRP1; FrzA; SARP2
• Note: Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 93%; Chicken: 93%

Reference Data

• Protein Families: Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway, Transmembrane
• Protein Pathways: Wnt signaling pathway