Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1 |
Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1 |
AAK1 (N-term) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | AAK1 antibody was raised against aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1. |
Rabbit polyclonal anti-AAK1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AAK1. |
AAK1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | AAK1 antibody was raised against aak1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of the human Aak1. |
Rabbit Polyclonal Aak1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1. |
AAK1 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the n-terminal region of human AAK1 |
Rabbit Polyclonal Aak1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aak1 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human Aak1. |
Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 antibody: synthetic peptide directed towards the C terminal of human AAK1. Synthetic peptide located within the following region: SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS |
Aak1 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |