CFL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFL2 |
CFL2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFL2 |
Rabbit Polyclonal Anti-Cfl2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cfl2 antibody is: synthetic peptide directed towards the C-terminal region of Cfl2. Synthetic peptide located within the following region: FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK |
Rabbit Polyclonal Anti-Cofilin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cofilin Antibody: A synthesized peptide derived from human Cofilin |
Rabbit polyclonal antibody to Cofilin 2 (cofilin 2 (muscle))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 92 and 166 of Cofilin 2 |
Rabbit Polyclonal antibody to Cofilin 2 (muscle) (cofilin 2 (muscle))
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 166 of Cofilin 2 (muscle) (Uniprot ID#Q9Y281) |
CFL2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFL2 |
CFL2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human CFL2 (NP_068733.1). |
Modifications | Unmodified |