Antibodies

Jump to Filters
View as table Download
CLEC14A Rabbit Polyclonal Antibody
TA331583

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLEC14A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC14A Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC14A. Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
CLEC14A Rabbit Polyclonal Antibody
TA367413

USD 380.00

4 Weeks

CLEC14A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLEC14A