Antibodies

View as table Download

Rabbit Polyclonal Bonzo Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,.

Rabbit Polyclonal Bonzo Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bonzo antibody was raised against a peptide corresponding to amino acids 319 to 338 of human origin. The sequence of this peptide is identical to those of macaque and African green monkey.

Rabbit Polyclonal Anti-CXCR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL

Rabbit Polyclonal Anti-CXCR6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CXCR6

CXCR6 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CXCR6

CXCR6 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the N-terminal region of human CXCR6. AA range:1-50