Bonzo (CXCR6) Rabbit Polyclonal Antibody

CAT#: TA330382

Rabbit Polyclonal Anti-CXCR6 Antibody

Product Images

WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: C-X-C motif chemokine receptor 6
• Database Link:
  NP_006555
  Entrez Gene 10663 Human
  UniProt ID O00574
• Background: CXCR6 is a receptor for the C-X-C chemokine CXCL16. It is used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.The CXCR6/AKT/mTOR pathway plays a central role in the development of prostate cancer. CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes. The CXCL16-CXCR6-system express in human schwannomas of different localization and in malignant peripheral nerve sheath tumors. The protein may play an important role in the retention of T cells within the lung.
• Synonyms: BONZO; CD186; STRL33; TYMSTR
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction