Rabbit Polyclonal anti-FGD1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the C terminal of human FGD1. Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT |
Rabbit Polyclonal Anti-FGD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGD1 antibody: synthetic peptide directed towards the N terminal of human FGD1. Synthetic peptide located within the following region: HGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSA |
FGD1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2). |
| Modifications | Unmodified |
FGD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human FGD1 (NP_004454.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
