Rabbit Polyclonal Anti-FICD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FICD antibody: synthetic peptide directed towards the C terminal of human FICD. Synthetic peptide located within the following region: GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP |
Rabbit Polyclonal Anti-FICD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FICD antibody: synthetic peptide directed towards the C terminal of human FICD. Synthetic peptide located within the following region: FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY |
FICD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 119-458 of human FICD (NP_009007.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
