Rabbit polyclonal Mst1/2 (Phospho-Thr183) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Mst1/2 around the phosphorylation site of threonine 183 (R-N-TP-V-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal Mst1/2 (Ab-183) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Mst1/Mst2 around the phosphorylation site of threonine 183 (R-N-TP-V-I). |
Rabbit Polyclonal MST1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
MST1 (+MST2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200 of Human MST1. |
Rabbit Polyclonal Anti-MST1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MST1 antibody: synthetic peptide directed towards the middle region of human MST1. Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE |
Rabbit Polyclonal Anti-MST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MST1. Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC |
Germany
Japan
United Kingdom
China
