Antibodies

View as table Download

Rabbit Polyclonal Anti-PGM3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the middle region of human PGM3. Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Rabbit Polyclonal Anti-PGM3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the N terminal of human PGM3. Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Rabbit Polyclonal antibody to PGM3 (phosphoglucomutase 3)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 44 and 321 of PGM3 (Uniprot ID#O95394)

PGM3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PGM3

PGM3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PGM3 (NP_056414.1).
Modifications Unmodified

PGM3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PGM3 (NP_056414.1).
Modifications Unmodified