PGM3 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human phosphoglucomutase 3 (PGM3)
USD 823.00
Other products for "PGM3"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PGM3 antibody: synthetic peptide directed towards the N terminal of human PGM3. Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 60 kDa |
Gene Name | phosphoglucomutase 3 |
Database Link | |
Background | This gene encodes a member of the phosphohexose mutase family. The encoded protein mediates both glycogen formation and utilization by catalyzing the interconversion of glucose-1-phosphate and glucose-6-phosphate. A non-synonymous single nucleotide polymorphism in this gene may play a role in resistance to diabetic nephropathy and neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010] |
Synonyms | AGM1; IMD23; PAGM; PGM 3 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data | |
Protein Pathways | Amino sugar and nucleotide sugar metabolism |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.