Ppara (1-18) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Hamster, Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to Amino Acids 1-18 of mouse PPAR alpha. N-Terminus |
Ppara (1-18) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Hamster, Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to Amino Acids 1-18 of mouse PPAR alpha. N-Terminus |
Rabbit polyclonal PPAR a (Ab-21) antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PPAR a around the phosphorylation site of serine 21 (L-E-SP-P-L). |
Anti-PPARA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha |
PPAR alpha (PPARA) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
PPAR alpha (PPARA) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 152-181 amino acids from the Central region of Human PPAR-alpha |
Rabbit polyclonal PPAR alpha antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat, Bovine, Dog, Golden Hamster, Boar |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1 to 18 of mouse PPAR alpha. |
Rabbit anti-PPARA polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human PPAR alpha. |
Rabbit Polyclonal Anti-PPARA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI |
Rabbit anti PPAR-gamma Polyclonal Antibody
Reactivities | Human |
Rabbit anti PPARa Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti PPARg Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PPARA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
Ppara Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
PPARα Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPARα. |
PPARα Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PPARα |
Modifications | Unmodified |
PPARα Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human PPARα (NP_001001928.1). |
Modifications | Unmodified |
PPAR alpha Rabbit polyclonal Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PPAR-alpha. AA range:6-55 |