PPAR alpha (PPARA) Rabbit Polyclonal Antibody

CAT#: TA334752

Rabbit Polyclonal Anti-PPARA Antibody

Product Images

WB Suggested Anti-PPARA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: OVCAR-3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: peroxisome proliferator activated receptor alpha
• Database Link:
  NP_005027
  Entrez Gene 5465 Human
  UniProt ID Q07869
• Background: Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq, Jul 2008]
• Synonyms: hPPAR; NR1C1; PPAR; PPARalpha
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Goat: 93%; Sheep: 93%; Bovine: 93%; Pig: 87%; Horse: 87%; Mouse: 87%; Dog: 80%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Adipocytokine signaling pathway, PPAR signaling pathway