Rabbit Polyclonal Anti-Blimp-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Blimp-1 Antibody: Peptide sequence around aa.124~128(D-T-V-P-K) derived from Human Blimp-1 |
Rabbit Polyclonal Anti-Blimp-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Blimp-1 Antibody: Peptide sequence around aa.124~128(D-T-V-P-K) derived from Human Blimp-1 |
Rabbit Polyclonal Blimp-1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2. |
Rabbit Polyclonal Blimp-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1. |
Rabbit Polyclonal Anti-PRDM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |
Rabbit polyclonal PRDM1 BLIMP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of human, mouse, and rat PRDM1/BLIMP1. |
Rabbit polyclonal PRDM1 Antibody (N-term)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This PRDM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 106-134 amino acids from the N-terminal region of human PRDM1. |
Rabbit Polyclonal Anti-PRDM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the N terminal of human PRDM1. Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN |
PRDM1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PRDM1 (NP_878911.1). |
Modifications | Unmodified |