QSOX2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | QSOX2 antibody was raised against synthetic 19 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (95%). |
QSOX2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Immunogen | QSOX2 antibody was raised against synthetic 20 amino acid peptide from C-Terminus of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%). |
QSOX2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Horse, Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | QSOX2 antibody was raised against synthetic 20 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Bat, Horse (100%); Rat, Bovine (95%); Dog, Hamster (90%); Panda, Opossum (85%); Turkey, Chicken (80%). |
QSOX2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Immunogen | QSOX2 antibody was raised against synthetic 15 amino acid peptide from internal region of human QSOX2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Marmoset (87%); Mouse, Rat, Dog, Elephant, Horse (80%). |
Rabbit Polyclonal Anti-Qsox2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Qsox2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Qsox2. Synthetic peptide located within the following region: SWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGSVLRARPWLGQMARLSHV |
Rabbit Polyclonal Anti-QSOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY |
QSOX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 370-650 of human QSOX2 (NP_859052.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
