QSOX2 Rabbit Polyclonal Antibody

CAT#: TA334359

Rabbit Polyclonal Anti-QSOX2 Antibody

Product Images

Host: Rabbit; Target Name: QSOX2; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-QSOX2 antibody is: synthetic peptide directed towards the middle region of Human QSOX2. Synthetic peptide located within the following region: VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: quiescin sulfhydryl oxidase 2
• Database Link:
  NP_859052
  Entrez Gene 169714 Human
  UniProt ID Q6ZRP7
• Background: QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family that regulates the sensitization of neuroblastoma cells for IFN-gamma-induced cell death.
• Synonyms: QSCN6L1; SOXN
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%; Rat: 85%; Horse: 85%; Guinea pig: 85%; Dog: 77%

Reference Data

• Protein Families: Transmembrane