SEC14 like protein 2 (SEC14L2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Mouse, Rabbit, Rat |
| Immunogen | KLH conjugated synthetic peptide between 41-69 amino acids from the N-terminal region of Human SEC14L2 |
Rabbit Polyclonal anti-SEC14L2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEC14L2 antibody: synthetic peptide directed towards the middle region of human SEC14L2. Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY |
SEC14L2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human SEC14L2 (NP_001191133.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
