SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody

CAT#: TA329409

Rabbit Polyclonal anti-SEC14L2 antibody

Product Images

WB Suggested Anti-SEC14L2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:7812500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEC14L2 antibody: synthetic peptide directed towards the middle region of human SEC14L2. Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: SEC14 like lipid binding 2
• Database Link:
  NP_036561
  Entrez Gene 23541 Human
  UniProt ID O76054
• Background: SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway.
• Synonyms: C22orf6; SPF; TAP; TAP1
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 87%; Rabbit: 87%

Reference Data

• Protein Families: Transcription Factors