Antibodies

View as table Download

SIRPG (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 192-221 amino acids from the Central region of Human SIRPG.

Rabbit polyclonal antibody to CD172 gamma (signal-regulatory protein gamma)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 298 of CD172 gamma (Uniprot ID#Q9P1W8)

Rabbit polyclonal anti-SIRPG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SIRPG.

Rabbit Polyclonal Anti-SIRPG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA

EDEM3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

SIRPG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-140 of human SIRPG (NP_543006.2).
Modifications Unmodified

Recombinant Anti-SIRP- beta & gamma (Clone OX117)

Applications ELISA, FC, IP
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.