Antibodies

View as table Download

Rabbit Polyclonal BAFF Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF.

Rabbit anti-TNFSF13B Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNFSF13B

Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Rabbit Polyclonal BAFF/BLyS/TNFSF13B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This rabbit polyclonal antibody was developed against a C-terminal peptide corresponding to amino acids 254-269 of human TNFSF13B.

Rabbit anti BAFF/BLys/Thank/Tall-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TNFSF13B Antibody - middlel region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TNFSF13B

TNFSF13B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFSF13B

Recombinant Anti-CD257 (BAFF) (Clone Tabalumab)

Applications ELISA, FC, IF, IP, Neutralize, WB
Reactivities Human, Monkey, Rabbit
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques.