Rabbit Polyclonal Anti-Ap1s1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ap1s1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ap1s1. Synthetic peptide located within the following region: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES |
AP1S1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AP1S1 |
AP1S1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human AP1S1 (NP_001274.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China