Antibodies

Jump to Filters
View as table Download
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA345107

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA326293

USD 345.00

4 Weeks

Rabbit polyclonal ACHE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ACHE.
Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody
TA350620

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACHE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACHE