Acetylcholinesterase (ACHE) Rabbit Polyclonal Antibody

CAT#: TA345107

Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region

Product Images

WB Suggested Anti-ACHE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysate

• 

  Sample Type : Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopPrimary Antibody Dilution : 1:50Secondary Antibody : Goat anti-rabbit-cy3Secondary Antibody Dilution : 1:500Color/Signal Descriptions : ACHE: Green Neural crest cells:: RedGene

• 

  Sample Type : Adult mouse tectumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-Cy3Secondary Antibody Dilution : 1:1000Color/Signal Descriptions : Red: Ache Cyan: Nissl (Neurons)Gene Name : ACHESubmitted by : Joshua R. Sanes, Molecular a

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: acetylcholinesterase (Cartwright blood group)
• Database Link:
  NP_056646
  Entrez Gene 11423 MouseEntrez Gene 43 Human
  UniProt ID P22303
• Background: This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. [provided by RefSeq, Jul 2008]
• Synonyms: ACEE; ARACHE; N-ACHE; YT
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Sheep: 91%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Glycerophospholipid metabolism