Antibodies

View as table Download

Rabbit Polyclonal Anti-Gps2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gps2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gps2. Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN

Rabbit polyclonal anti-NCR1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCR1.

Rabbit Polyclonal Anti-NCR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCR1

NCR1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

NCR1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated