Rabbit anti-CDA Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDA |
Rabbit anti-CDA Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDA |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit anti-TK1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TK1 |
Rabbit anti-FBP1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FBP1 |
Rabbit Polyclonal DNMT3B Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Rabbit polyclonal GOT2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit polyclonal TK (Ab-13) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Rabbit anti-DHFR Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DHFR |
DNMT3B Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human DNMT3B |
Rabbit polyclonal Anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
Anti-DHFR Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-PPAP2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 256-269 amino acids of Human phosphatidic acid phosphatase type 2C |
Rabbit anti-HPRT1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPRT1 |
Rabbit anti-PNP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PNP |
Rabbit Polyclonal Anti-HPRT1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939) |
Rabbit polyclonal TK (Ser13) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-POLG2 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLG2. |
Anti-PPAP2C Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal TK (Ser13) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TK around the phosphorylation site of Serine 13 |
Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Anti-POLR1C Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa |
Rabbit Polyclonal TK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TK |
Rabbit polyclonal POLD2 Antibody (Center)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBP1 |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GOT2 |
Rabbit Polyclonal Anti-DHCR24 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DHCR24 |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATIC |
Rabbit Polyclonal Anti-PHGDH Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHGDH |
Rabbit Polyclonal anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT3B |
Rabbit Polyclonal anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT3B |