HPRT (HPRT1) Rabbit Polyclonal Antibody

CAT#: TA346669

Rabbit Polyclonal Anti-HPRT1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human hypoxanthine phosphoribosyltransferase 1 (HPRT1)
    • 20 ug

USD 823.00


Transient overexpression lysate of hypoxanthine phosphoribosyltransferase 1 (HPRT1)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "HPRT1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 24 kDa
Gene Name hypoxanthine phosphoribosyltransferase 1
Background The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout. [provided by RefSeq, Jun 2009]
Synonyms HGPRT; HPRT
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.