LIMPII (SCARB2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | SCARB2 antibody was raised against 16 amino acid peptide from near the center of human LIMP2 |
LIMPII (SCARB2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | SCARB2 antibody was raised against 16 amino acid peptide from near the center of human LIMP2 |
Rabbit Polyclonal LIMP2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LIMP2 antibody was raised against a 16 amino acid peptide from near the center of human LIMP2. |
Rabbit Polyclonal LIMPII/lpg85 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Primate |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114] |
Rabbit Polyclonal LIMP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | LIMP2 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human LIMP2. |
Rabbit Polyclonal LIMPII/SR-B2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Hamster |
Conjugation | Unconjugated |
Immunogen | A peptide containing residues from mouse SR-BII (between residues 400-478) plus an N-terminal cysteine was coupled to KLH. [UniProt# O35114] |
Rabbit Polyclonal Anti-SCARB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCARB2 antibody is: synthetic peptide directed towards the C-terminal region of Human SCARB2. Synthetic peptide located within the following region: KSMINTTLIITNIPYIIMALGVFFGLVFTWLACKGQGSMDEGTADERAPL |
SCARB2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |