Rabbit polyclonal Ephrin B1/B2/B3 (Tyr324) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2/B3 around the phosphorylation site of tyrosine 324 (G-D-YP-G-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Ephrin B1/B2 (Tyr329) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Ephrin B1/B2 around the phosphorylation site of tyrosine 329 (P-V-YP-I-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal EFNB1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EFNB1/2 |
Ephrin B1 (EFNB1) (+Ephrin-B2) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 300-340 of Human Ephrin-B1. |
Ephrin B1 (EFNB1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-EFNB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFNB1 antibody: synthetic peptide directed towards the middle region of human EFNB1. Synthetic peptide located within the following region: SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG |
Rabbit anti Ephrin B1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full length (1-346aa) human Ephrin-B1 protein expressed in E.coli |
EFNB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 259-346 of human EFNB1 (NP_004420.1). |
| Modifications | Unmodified |
EFNB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-237 of human EFNB1 (NP_004420.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
