Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the middle region of human EGLN2. Synthetic peptide located within the following region: AVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIF |
EGLN2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human EGLN2 |
EGLN2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 95-123 amino acids from the N-terminal region of human EGLN2 |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGLN2 Antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL |
Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1). |
| Modifications | Unmodified |
Prolyl hydroxylase PHD1 (EGLN2) Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) (NP_444274.1). |
| Modifications | Unmodified |
PHD1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PHD1/prolyl hydroxylase |
Germany
Japan
United Kingdom
China
