Antibodies

Jump to Filters
View as table Download
FNDC8 Rabbit Polyclonal Antibody
TA344990

USD 475.00

5 Days

Rabbit Polyclonal Anti-FNDC8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FNDC8 antibody: synthetic peptide directed towards the N terminal of human FNDC8. Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL
FNDC8 (Center) Rabbit Polyclonal Antibody
AP51693PU-N

USD 450.00

2 Weeks

FNDC8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 211-240 amino acids from the Central region of Human FNDC8