FNDC8 Rabbit Polyclonal Antibody

CAT#: TA344990

Rabbit Polyclonal Anti-FNDC8 Antibody - N-terminal region

Product Images

WB Suggested Anti-FNDC8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: OVCAR-3 cell lysateFNDC8 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FNDC8 antibody: synthetic peptide directed towards the N terminal of human FNDC8. Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: fibronectin type III domain containing 8
• Database Link:
  NP_060029
  Entrez Gene 54752 Human
  UniProt ID Q8TC99
• Background: The function of FNDC8 remains unknown.
• Synonyms: DKFZp434H2215
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Bovine: 79%