Rabbit Polyclonal Anti-FNDC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FNDC8 antibody: synthetic peptide directed towards the N terminal of human FNDC8. Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL |
FNDC8 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 211-240 amino acids from the Central region of Human FNDC8 |
Carrier-free (glycerol/BSA-free) FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
