Antibodies

Jump to Filters
View as table Download
KLF14 Rabbit Polyclonal Antibody
TA341450

USD 375.00

5 Days

Rabbit Polyclonal Anti-KLF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA
KLF14 Rabbit Polyclonal Antibody
TA377836

USD 220.00

3 Weeks

KLF14 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KLF14.