KLF14 Rabbit Polyclonal Antibody

CAT#: TA341450

Rabbit Polyclonal Anti-KLF14 Antibody

Product Images

WB Suggested Anti-KLF14 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: Kruppel-like factor 14
• Database Link:
  NP_619638
  Entrez Gene 136259 Human
  UniProt ID Q8TD94
• Background: This intronless gene encodes a member ofThe Kruppel-like family of transcription factors.The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression.This gene exhibits imprinted expression fromThe maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013]
• Synonyms: BTEB5
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93%