KLF14 Rabbit Polyclonal Antibody
Other products for "KLF14"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KLF14 antibody: synthetic peptide directed towards the N terminal of human KLF14. Synthetic peptide located within the following region: SAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 33 kDa |
Gene Name | Kruppel-like factor 14 |
Database Link | |
Background | This intronless gene encodes a member ofThe Kruppel-like family of transcription factors.The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression.This gene exhibits imprinted expression fromThe maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013] |
Synonyms | BTEB5 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.