Antibodies

Jump to Filters
View as table Download
MSC Rabbit Polyclonal Antibody
TA314883

USD 345.00

In Stock

Rabbit polyclonal anti-Musculin antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Musculin.
MSC Rabbit Polyclonal Antibody
TA347547

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Musculin Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Musculin Antibody: A synthesized peptide derived from human Musculin
MSC Rabbit Polyclonal Antibody
TA342279

USD 375.00

5 Days

Rabbit Polyclonal Anti-Msc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Msc antibody: synthetic peptide directed towards the C terminal of mouse Msc. Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS