Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NDRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the C terminal of human NDRG1. Synthetic peptide located within the following region: GSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGA |
NDRG1 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human NDRG1 |
Rabbit Polyclonal Anti-NDRG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the N terminal of human NDRG1. Synthetic peptide located within the following region: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG |
NDRG1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human NDRG1 |
NDRG1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NDRG1 |
Phospho-NDRG1-T346 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T346 of human NDRG1 (NP_001128714.1). |
| Modifications | Phospho T346 |
Phospho-NDRG1-S330 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1). |
| Modifications | Phospho S330 |
Active filters
Target Symbol
- NDRG1
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal