Antibodies

Jump to Filters
View as table Download
P2rx6 Rabbit Polyclonal Antibody
TA329001

USD 585.00

3 Weeks

Rabbit polyclonal Anti-P2X6 Receptor

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RTKYEEARAPKATTNSA, corresponding to amino acid residues 363-379 of rat P2X6 Receptor?. Intracellular, C-terminus.
P2X6 (P2RX6) Rabbit Polyclonal Antibody
TA338553

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: NWRVGALQRLLQFGIVVYVVGWALLAKKGYQERDLEPQFSIITKLKGVSV
P2X6 (P2RX6) Rabbit Polyclonal Antibody
TA338554

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RXL1 antibody: synthetic peptide directed towards the N terminal of human P2RXL1. Synthetic peptide located within the following region: ERDLEPQFSIITKLKGVSVTQIKELGNRLWDVADFVKPPQGENVFFLVTN
P2X6 (P2RX6) Rabbit Polyclonal Antibody
TA379551

USD 220.00

3 Weeks

P2RX6 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-280 of human P2RX6 (NP_001153026.1).
Modifications Unmodified