Rabbit Polyclonal Anti-PCSK6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: NYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGI |
Rabbit Polyclonal Anti-PCSK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCSK6 antibody: synthetic peptide directed towards the N terminal of human PCSK6. Synthetic peptide located within the following region: IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR |
Rabbit Polyclonal Anti-PCSK6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PACE4 / PCSK6 antibody was raised against synthetic 16 amino acid peptide from internal region of human PACE4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rabbit (100%); Marmoset (94%); Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum (88%); Bat (81%). |
Germany
Japan
United Kingdom
China