Antibodies

Jump to Filters
View as table Download
LOC105369264 (Center) Rabbit Polyclonal Antibody
AP53510PU-N

USD 450.00

2 Weeks

LOC105369264 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 185-215aa) of human PTPN20A.
PTPN20B (PTPN20) Rabbit Polyclonal Antibody
TA331943

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN20B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN20B Antibody is: synthetic peptide directed towards the N-terminal region of Human PTPN20B. Synthetic peptide located within the following region: ETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVFEEPSESGS
PTPN20B (PTPN20) Rabbit Polyclonal Antibody
TA351565

USD 345.00

In Stock

Rabbit Polyclonal Anti-PTPN20B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN20B
PTPN20 Rabbit Polyclonal Antibody
TA367210

USD 380.00

4 Weeks

PTPN20 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN20