Antibodies

Jump to Filters
View as table Download
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA327283

USD 275.00

3 Weeks

AURKA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human AURKA
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA325248

USD 345.00

4 Weeks

Rabbit Polyclonal Aurora Kinase (Thr288) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Aurora Kinase around the phosphorylation site of Threonine 288
Modifications Phospho-specific
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA336807

USD 424.00

5 Days

Rabbit Polyclonal Aurora A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human Aurora A protein (within residues 50-200). [Swiss-Prot O14965]
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA347975

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AurA Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-AurA Antibody: A synthesized peptide derived from human AurA
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA325247

USD 345.00

In Stock

Rabbit Polyclonal Aurora Kinase Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Aurora Kinase
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA333165

USD 345.00

3 Weeks

Phospho-AURKA-T288 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T288 of human AURKA
Modifications Phospho-specific
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA329186

USD 375.00

5 Days

Rabbit Polyclonal anti-AURKA antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AURKA antibody: synthetic peptide directed towards the C terminal of human AURKA. Synthetic peptide located within the following region: ARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
Aurora A (AURKA) Rabbit Polyclonal Antibody
TA335339

USD 375.00

5 Days

Rabbit Polyclonal Anti-AURKA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AURKA Antibody is: synthetic peptide directed towards the middle region of Human AURKA. Synthetic peptide located within the following region: REKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF