Antibodies

View as table Download

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen P2RX7 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human P2RX7.

Rabbit Polyclonal Anti-PDIA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PDIA1 antibody was raised against a 17 amino acid peptide near the center of human PDIA1.

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP

Rabbit Polyclonal Anti-P2RX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP